PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10208000g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 602aa    MW: 64855.8 Da    PI: 5.8017
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10208000g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-173683148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  MA_10208000g0010 36 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 83
                      79******************************************9986 PP

2Myb_DNA-binding52.11.5e-1689132146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++T+eE++++++++++lG++ W++ a+ ++ gRt++++k++w++
  MA_10208000g0010  89 KGAFTAEEEQIIIELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 132
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2143183IPR017930Myb domain
SuperFamilySSF466893.74E-3034130IPR009057Homeodomain-like
SMARTSM007172.1E-153585IPR001005SANT/Myb domain
PfamPF002492.2E-153683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-243790IPR009057Homeodomain-like
CDDcd001678.05E-123883No hitNo description
PROSITE profilePS5129426.24384138IPR017930Myb domain
SMARTSM007173.5E-1688136IPR001005SANT/Myb domain
PfamPF002492.7E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2591137IPR009057Homeodomain-like
CDDcd001671.16E-1191132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MSSETSDSGA TKEQQTLDAG GEVIGGGNGG GGSLKKGPWT SAEDAILVEY VKKHGEGNWN  60
AVQKHSGLFR CGKSCRLRWA NHLRPNLKKG AFTAEEEQII IELHAKLGNK WARMAAQLPG  120
RTDNEIKNYW NTRIKRRQRQ GLPLYPPDLP LQQSNNENQQ NQQPINGADA AISQHNHSHN  180
HHEFLSSSTK LEIPNVTFDS LKPGQHALTF TSFPALTEVS MSSILNQALG LSQGYRMVNP  240
IQRAKRIRDS ESMMSFGVGG GGISPFGQFV DDTPTKSIGE PCFKTARRLP YAQPARLDGS  300
SYAQPARLDG FVANGFPYDP NLSNRNSNLN LSTPFGGLMI GSHALLNGNL SPPTPLSGVK  360
LELPSSQLAE SVHTTGTRLE TVTTDNNSYT LPPPVPSNHV DGFSPHNSGL LEALLHESQA  420
MGGGGNKRSS EMITQLPPIS SRSNLTNCVV ASQSETECGE YSDPITPLGG PAASVFSENT  480
PPLSTSPWDE SSSAQSAIGV NIKTEERNEF MSSANCGDEE FSTLLNLARP DVSPVSDWYD  540
SHAEVEKDHS AVSDALATLF NDDFCVDIQQ LASGPSTSNQ AWGLGSCHWN NMPGVTQIAD  600
LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-33341375107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1578470.0JX157847.1 Larix kaempferi myb domain protein 33 (MYB33) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR4IK400.0R4IK40_9SPER; Myb domain protein 33
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.12e-65myb domain protein 33